research peptide raises a handful of sensible questions. This page answers them in order, starting with the fundamentals and moving to applications.
Reviewed 2026-03-02. Anything still debated is marked as such rather than presented as settled.
No major regulatory agency has approved TB-500 for therapeutic use, and it holds no pharmacopoeial monograph. The name appears on the World Anti-Doping Agency prohibited list within the class covering peptide hormones, growth factors, and related substances. Detection in doping control relies on mass spectrometric methods applied to urine, often after preparation steps that concentrate the analyte. Discussion of TB-500 therefore clusters in biochemistry, sports medicine, and anti-doping literature rather than in registered clinical trials.
TB-500 is a synthetic peptide preparation marketed under a name derived from thymosin beta-4, a 43-residue actin-binding protein first isolated from thymus tissue. The full-length protein has a reported molecular mass near 4963 Da, while material sold as TB-500 is often described as a fragment containing the actin-binding motif LKKTETQ. Because suppliers use the name inconsistently, published sources sometimes refer to the same label as a fragment, a synthetic copy, or a related analog. This naming ambiguity complicates direct comparison of reports across studies.
The compound circulates in the literature as a research reagent rather than an approved therapeutic. Regulatory agencies in several countries have not authorized it for medical use, and sporting bodies list related thymosin beta-4 peptides among prohibited substances. Suppliers typically market it with a purity figure and a certificate of analysis, while peer-reviewed clinical reports remain sparse. Discussions therefore often separate laboratory findings from anecdotal reports, and reviewers tend to note the small size and methodological limits of the available studies.
TB-500 refers to a synthetic peptide fragment derived from the actin-binding region of thymosin beta-4, a protein present in most mammalian cells. The full protein contains forty-three amino acids, while the commonly sold fragment is a much shorter acetylated sequence, often cited as LKKTETQ. The fragment retains part of the actin-binding motif but lacks the remainder of the parent protein. Material sold under this name is usually lyophilized powder intended for laboratory research, and it is not a finished pharmaceutical product.
Proposed activity centers on actin sequestration and on the movement of cells during repair processes. In cell culture and animal models, the fragment has been associated with migration, tube formation, and tissue remodeling. These observations are frequently described as preliminary, because most published work uses rodent or in vitro systems rather than controlled human trials. Whether the short fragment reproduces the effects of the full protein remains an open question, and the relationship between dose, route, and measured outcome is not well characterized.
| Property | Value | Notes |
|---|---|---|
| Molecular mass | Approximately 4963 Da for full-length thymosin beta-4 | Value applies to the parent protein; fragment products may differ |
| Appearance | White to off-white lyophilized powder | Typical form of supplied synthetic peptide |
| Solubility | Freely soluble in water | Polar peptide; dissolves readily in aqueous buffer |
| Storage of dry powder | −20 °C, desiccated, protected from light | Standard laboratory practice for peptides |
| Typical detection method | Liquid chromatography–tandem mass spectrometry | Used in purity testing and anti-doping analysis |
Thymosin beta-4 was isolated from calf thymus in the early 1980s and later characterised as an abundant intracellular actin-sequestering protein. Interest in short synthetic fragments grew once the actin-binding motif had been mapped to the middle of the sequence. TB-500 came out of that line of work as a truncated analogue rather than a natural isolate, and it is now sold mainly to laboratories. Published studies on the fragment have been largely in vitro or in animal models, and controlled human trials remain sparse, so claims about effects in people rest on extrapolation.
Literature and online discussion often conflate TB-500 with full-length thymosin beta-4, even though the two differ in size and are not interchangeable in analytical terms. The fragment is produced by solid-phase peptide synthesis, and the product is a defined seven-residue chain rather than a biological extract. Because the term is a trade-style label, two vendors may supply materials of the same nominal sequence but different counter-ion content, purity, or water content. Comparisons across studies are therefore difficult unless the exact sequence and purity are reported.
TB-500 is a research peptide whose sequence matches residues 17 to 23 of thymosin beta-4, a 43-residue protein present in most mammalian cells. The chain is seven amino acids long, written as LKKTETQ, and is normally supplied with an acetyl group on the N-terminus. Suppliers list it as a lyophilised powder under the code name TB-500, and the same sequence appears elsewhere in catalogues as the thymosin beta-4 actin-binding fragment. The label is commercial rather than systematic, so no single authority fixes exactly what TB-500 denotes.
Lyophilized TB-500 is hygroscopic and should be kept dry before use. The usual storage recommendation for the solid is -20 °C, protected from light and moisture. Once dissolved, the peptide is less stable, and repeated freeze-thaw cycles can promote aggregation or degradation. Laboratories often divide a reconstituted solution into single-use aliquots and store them at -80 °C. Exact stability limits depend on buffer, pH, and concentration, so published data do not define a single universal condition.
Identity and purity are checked with chromatographic and mass spectrometric methods. Reverse-phase high-performance liquid chromatography separates the peptide from related impurities, while mass spectrometry confirms the expected molecular mass. A certificate of analysis may report a purity percentage, but the laboratory should still verify the material independently. Common quality concerns include truncated sequences, deamidation, oxidation, and residual solvents from synthesis. Because TB-500 is short, some impurities can differ from the target by only a few mass units.
Once in solution, short peptides are generally less stable than the dry powder, and repeated freeze-thaw cycles are a common cause of loss. Laboratory guidance usually calls for aliquoting on first dissolution and storing aliquots at -20 °C or below, away from light. Adsorption to plastic and glass surfaces can lower measured concentration, particularly at low concentrations, so container material and buffer choice can affect results. Visible cloudiness, colour change or unexpected precipitate is a signal to re-check the material.
Purity is normally assessed by reversed-phase HPLC, with the main peak reported as a percentage of total peak area, while identity is confirmed by mass spectrometry. Electrospray and MALDI-TOF instruments are both used, and the observed mass is compared with the value calculated from the stated sequence. Ion-exchange or size-exclusion methods appear where aggregation or charge variants are of interest. Water content, counter-ion content and residual trifluoroacetate from purification are separate variables that can shift the measured mass and should be weighed when reading a certificate of analysis.
Research peptides are typically supplied as a white to off-white lyophilised powder in a sealed vial. The dry solid is more stable than a solution and is normally kept refrigerated or frozen until use. Dissolution is usually done in water, phosphate-buffered saline or a similar aqueous medium, depending on the assay. Because the material is hygroscopic and easily contaminated, opening vials in a low-humidity environment and recording the lot number before use are standard laboratory practices.
The majority of serpin diseases are due to protein aggregation and are termed "serpinopathies". Serpins are vulnerable to disease-causing mutations that promote formation of misfolded polymers due to their inherently unstable structures. Well-characterised serpinopathies include α1-antitrypsin deficiency (alpha-1), which may cause familial emphysema, and sometimes liver cirrhosis, certain familial forms of thrombosis related to antithrombin deficiency, types 1 and 2 hereditary angioedema (HAE) related to deficiency of C1-inhibitor, and familial encephalopathy with neuroserpin inclusion bodies (FENIB; a rare type of dementia caused by neuroserpin polymerisation). Each monomer of the serpin aggregate exists in the inactive, relaxed conformation (with the RCL inserted into the A-sheet). The polymers are therefore hyperstable to temperature and unable to inhibit proteases. Serpinopathies therefore cause pathologies similarly to other proteopathies (e.g. prion diseases) via two main mechanisms. First, the lack of active serpin results in uncontrolled protease activity and tissue destruction. Second, the hyperstable polymers themselves clog up the endoplasmic reticulum of cells that synthesize serpins, eventually resulting in cell death and tissue damage. In the case of antitrypsin deficiency, antitrypsin polymers cause the death of liver cells, sometimes resulting in liver damage and cirrhosis. Within the cell, serpin polymers are slowly removed via degradation in the endoplasmic reticulum.
The compound needs to be carried to its effector site, most often via the bloodstream. From there, the compound may distribute into muscle and organs, usually to differing extents. After entry into the systemic circulation, either by intravascular injection or by absorption from any of the various extracellular sites, the drug is subjected to numerous distribution processes that tend to lower its plasma concentration. Distribution is defined as the reversible transfer of a drug between one compartment to another. Some factors affecting drug distribution include regional blood flow rates, molecular size, polarity and binding to serum proteins, forming a complex. Distribution can be a serious problem at some natural barriers like the blood–brain barrier.
== History == Avasimibe was the result of a rational drug design process carried out at Parke-Davis in the early 1990s which sought to obtain orally bioavailable, water-soluble ACAT inhibitors; all such inhibitors known at the time were lipophilic and poorly absorbed when taken by mouth. This process yielded several compounds with potential, including one (designated PD 138142–15) with good solubility in water and remarkable efficacy in animal studies, but it was chemically unstable and degraded rapidly, especially in acidic environments. (Undesirable CYP450 induction was first noted at this time, in PD 138142-15 and its degradation products.) Chemical modification of PD 138142-15 and retrosynthetic analysis found that avasimibe (then codenamed CI-1011) could be easily manufactured from commercially available starting compounds, and once its efficacy was demonstrated in vitro and in rat studies, it was selected for further development. After additional safety and preclinical efficacy studies in animals, phase I clinical trials in humans began in 1997, first for hyperlipidemia (June) and subsequently for atherosclerosis (December). Phase II trials for both indications followed in 1998, and phase III trials in 2001. In October 2003, clinical development of avasimibe was discontinued. Later research discredited the concept of ACAT inhibition as a treatment for dyslipidemia and atherosclerosis, and interest in these compounds as a class waned accordingly.
== College career == Bill Denehy, head coach of the University of Hartford, offered Bagwell a scholarship in spite of baseball not being his primary sport. Bagwell's acceptance of Hartford's baseball scholarship was based at least in part on the lack of a professional soccer league in the United States at the time. At Hartford, Denehy switched Bagwell to third base. Over three seasons playing for Hartford, he batted .413 in 400 at bats, a school record, and, for a time, a New England collegiate record. He also was the school's career home run (31) and run batted in (126) leader when he was drafted, and a two-time Eastern College Athletic Conference player of the year. In 1987 and 1988, he played collegiate summer baseball for the Chatham A's of the Cape Cod Baseball League, and in 1988 was named the starting third baseman for the East Division in the league's annual all-star game.
In Hungary, a government advisory body recommended mephedrone should be made illegal in August 2010, which was followed, making it illegal in January 2011; Spain followed in February 2011. Mexico, by decree, outlawed mephedrone as a substance "with low or no therapeutical use which pose[s] a serious threat to public health" in 2014. In some countries, mephedrone is not specifically listed as illegal, but is controlled under legislation that makes compounds illegal if they are analogs of drugs already listed. In Australia during 2010, it was not specifically listed as prohibited, but the Australian Federal Police stated it is an analogue to methcathinone and therefore illegal. It is now listed as a Schedule 9 prohibited substance in Australia under the Poisons Standard (October 2015). A Schedule 9 substance is a substance which may be abused or misused, the manufacture, possession, sale or use of which should be prohibited by law except when required for medical or scientific research, or for analytical, teaching or training purposes with approval of Commonwealth and/or State or Territory Health Authorities. In February 2010, 22 men were arrested in connection with importing mephedrone. By January 2011, every state in Australia, other than Victoria, had listed it as a controlled drug.
Sources: en.wikipedia.org
2 PaI5 → 2 Pa + 5 I2 In 1961, the United Kingdom Atomic Energy Authority (UKAEA) produced 127 grams of 99.9% pure protactinium-231 by processing 60 tonnes of waste material in a 12-stage process, at a cost of about US$500,000. For many years, this was the world's only significant supply of protactinium, which was provided to various laboratories for scientific studies. The Oak Ridge National Laboratory in the US provided protactinium at a cost of about US$280/gram.
=== Hormone excess === If there is an excess of growth hormone, it is usually because of over-secretion of somatotrope cells in the anterior pituitary gland. A significant amount of excess somatotrope secretion before puberty or before the end of new bone tissue growth can lead to gigantism, a disease that causes excess growth of body (e.g. being over 7 ft. tall) and unusually long limbs. An excess of secretion of growth hormone after puberty can lead to acromegaly. This is a disease that causes abnormal growth in the hands, head, jaw, and tongue. Some symptoms associated with acromegaly include heavy sweating, oily skin, improper processing of sugars in the diet (diabetes), high blood pressure, increased calcium in urine and swelling of the thyroid gland and arthritis.
Betaine transporter (SLC6A12) InterPro: IPR002983 Creatine transporter (SLC6A8) InterPro: IPR002984 Dopamine neurotransmitter transporter (SLC6A3) InterPro: IPR002436 Inebriated neurotransmitter transporter InterPro: IPR002944 GABA neurotransmitter transporter GAT-1 (SLC6A1) InterPro: IPR002980 GABA neurotransmitter transporter GAT-2 (SLC6A13) InterPro: IPR002981 GABA neurotransmitter transporter GAT-3 (SLC6A11) InterPro: IPR002982 Glycine neurotransmitter transporter, type 1 (SLC6A9) InterPro: IPR003028 Noradrenaline neurotransmitter transporter (SLC6A2) InterPro: IPR002435 Orphan neurotransmitter transporter (SLC6A15) InterPro: IPR002438 Serotonin (5-HT) neurotransmitter transporter, N-terminal (SLC6A4) InterPro: IPR013086 Taurine transporter (SLC6A6) InterPro: IPR002434
In 2020, some major companies and institutions started to acquire bitcoin: MicroStrategy invested $250 million in bitcoin as a treasury reserve asset, Square, Inc., $50 million, and MassMutual, $100 million. In November 2020, PayPal added support for bitcoin in the US. In February 2021, bitcoin's market capitalization reached $1 trillion for the first time. In November 2021, the Taproot soft-fork upgrade was activated, adding support for Schnorr signatures, improved functionality of smart contracts and Lightning Network. Before, bitcoin only used a custom elliptic curve with the ECDSA algorithm to produce signatures. In September 2021, bitcoin became legal tender currency in El Salvador, alongside the US dollar. In October 2021, the first bitcoin futures exchange-traded fund (ETF), called BITO, from ProShares was approved by the SEC and listed on the CME. In early 2022, during the Canadian trucker protests opposing COVID-19 vaccine mandates, organizers turned to bitcoin to receive donations after traditional financial platforms restricted access to funding. Proponents highlighted bitcoin's use as a tool for fundraising in situations where access to conventional financial systems may be restricted. In May and June 2022, the bitcoin price fell following the collapses of TerraUSD, a stablecoin, and the Celsius Network, a cryptocurrency loan company. In 2023, ordinals—non-fungible tokens (NFTs)—on bitcoin, went live. As of June 2023, River Financial estimated that bitcoin had 81.7 million users, about 1% of the global population.
Sources: en.wikipedia.org
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
SNX8 is thought to be an adaptor protein involved in the endosome-to-Golgi transport pathway, participating in endocytosis and endosomal sorting and signaling. It downregulates retrograde transport of intracellular proteins from the early endosome compartment to the trans-Golgi network in a retromer-mediated manner. SNX8 is therefore localized in early endosomes, as its colocalization with components of the retromer such as SNX1, SNX2, Vps26 and Vps35 has been demonstrated by some studies (and also with EEA1). Furthermore, the dynamics of endosomal structures with SNX8-enriched membrane domains are regulated by the opposite motor proteins dynein-1 containing LIC1 and kinesin-1, both of which allow SNX8-mediated cargo movement through the cytosol by exerting forces on these structures. The biological functions of SNX8 that have been studied, all of which involve its role in intracellular endosomal transport, are explained in more detail in the following sections.
Lawsuits against Merck & Co. regarding the marketing and use of Vioxx The landmark whistleblower case involving Neurontin (gabapentin) and off-label marketing: United States of America ex rel. David Franklin vs. Parke-Davis, Division of Warner-Lambert/Pfizer Investigations into conflict of interest and academic institutions by the US Senate Finance Committee, headed by Charles Grassley (R-Iowa) Investigations into the marketing of Vioxx to physicians by the United States House Committee on Oversight and Government Reform, headed by Henry A. Waxman Antitrust litigation involving Abbott Labs and their HIV/AIDS drug Norvir Lawsuits against Wyeth for the unethical promotion of the hormone replacement drug Premarin to women. Wyeth paid medical ghostwriters to author journal articles about the drug.
Sources: en.wikipedia.org
Not necessarily. TB-500 is a commercial label that suppliers apply to synthetic peptides described as thymosin beta-4 or a fragment of it. Published research most often studies the full-length protein, so statements about one do not automatically transfer to the other.
No. No major regulatory authority lists an approved product under this name, and no pharmacopoeial monograph exists for it. Material sold under the label is therefore supplied outside approved pharmaceutical channels, which affects the quality documentation available.
It falls within a prohibited class covering peptide hormones and growth factors, based on presumed effects on tissue repair and blood vessel formation. Anti-doping laboratories have published mass spectrometry methods for detecting thymosin beta-4 related peptides in urine samples.
TB-500 is a name used for a short synthetic peptide fragment taken from the actin-binding region of thymosin beta-4. Material sold under this label is usually a lyophilized powder supplied for laboratory research rather than a licensed medicine. The commonly cited sequence is LKKTETQ.