This is a working overview of trifluoroacetate, written for readers who want more than a one-paragraph summary but less than a textbook.
Reviewed 2025-10-14. Anything still debated is marked as such rather than presented as settled.
Interest in the fragment grew during the 1990s and 2000s, when it moved from laboratory work into sports and supplement markets. Anti-doping bodies added thymosin beta-4 fragments to prohibited lists, and a small number of adverse analytical findings have been reported in competition testing. Published controlled human trials remain scarce. Most mechanistic evidence comes from cell culture and animal models, and those studies examine endpoints such as cell migration, wound closure and inflammation markers. That evidence supports research interest but does not establish clinical benefit, and broad regenerative claims should be read as unverified.
TB-500 is a short synthetic peptide sold under a trade name rather than a systematic chemical name. Suppliers usually describe it as a fragment of thymosin beta-4 and ship it as a lyophilised powder intended for laboratory use. Because the label is commercial, the exact sequence attributed to it is not fully consistent across catalogues, and some listings present a seven-residue peptide while others describe related fragments of similar length. It is not an approved medicine in any major jurisdiction, and it is handled as a research chemical.
The seven-residue chain carries several polar and charged side chains, so it dissolves readily in water and in aqueous buffers near neutral pH. No cysteine is present, so disulphide formation is not a concern and reducing agents are unnecessary. Dilute ammonium hydroxide or acetonitrile-water mixtures are sometimes used for stock solutions when initial dissolution is slow. Strongly alkaline conditions and prolonged contact with oxidising agents are avoided because they can modify lysine-containing stretches, and haze in solution usually signals incomplete dissolution or aggregated material.
Identity and purity are checked with reversed-phase high-performance liquid chromatography, which separates the target sequence from truncated or deletion analogues, and with mass spectrometry, which confirms the expected molecular mass. Amino acid analysis and peptide mapping give orthogonal confirmation but are used less often outside specialist laboratories. Counter-ion content varies: material purified on trifluoroacetic acid gradients retains trifluoroacetate, and ion exchange can convert the salt form. Residual water and solvent are measured by Karl Fischer titration or thermogravimetric analysis, and any purity figure should be read together with the method used to obtain it.
| Property | Value | Notes |
|---|---|---|
| Name type | Commercial trade name | Not a systematic chemical identifier |
| Parent peptide | Thymosin beta-4 | 43-residue natural peptide |
| Common fragment sequence | LKKTETQ | Maps to part of the actin-binding region |
| Molecular size class | Roughly 0.8-1.0 kDa | Depends on exact fragment and terminal modification |
| Regulatory status | Prohibited in sport | Grouped with peptide hormones in many frameworks |
Identity and purity are assessed with a small set of standard techniques. Reverse-phase high-performance liquid chromatography gives a purity estimate from peak area, usually recorded at 214 or 220 nanometers, where the peptide bond absorbs. Mass spectrometry confirms the expected molecular mass and can reveal truncated or oxidized species. Amino acid analysis or tandem mass spectrometry sequencing can verify the sequence itself. Additional quality attributes include water content, residual trifluoroacetic acid carried over from purification, and endotoxin where the material is intended for biological work.
The compound is most often distributed as a lyophilized powder, appearing white to off-white and forming a loose cake or fluffy solid. It is hygroscopic to some degree, so brief exposure to humid air can add water weight and complicate weighing. The peptide dissolves readily in water and in neutral aqueous buffers, and aqueous solubility is generally described as high, well above the concentrations used in typical assays. Some polar organic solvents are also usable, which matters when a concentrated stock is prepared before dilution into buffer.
Identity and purity are usually assessed by reversed-phase high-performance liquid chromatography together with mass spectrometry. The chromatogram provides a purity estimate as a percentage of total peak area, while the mass spectrum confirms that the observed mass matches the expected value. Amino acid analysis or tandem mass spectrometry sequencing can provide additional confirmation. Reported purity figures depend on the column, gradient, and detection wavelength, so values from different laboratories are not directly comparable without method details.
Lyophilised peptide is normally reconstituted with sterile water or a neutral buffer shortly before use. Because repeated freeze-thaw cycles can degrade the material, dividing a reconstituted solution into single-use aliquots is a common practice. Working solutions are usually kept cold and protected from light. The exact shelf life depends on concentration, buffer composition, and handling, so it is often determined empirically rather than assumed.
Purity and identity are separate measurements and are often confused. Reverse-phase high-performance liquid chromatography, usually with ultraviolet detection near 214 nanometres, reports the share of total peak area belonging to the target compound. Mass spectrometry by electrospray or matrix-assisted laser desorption then checks whether the observed mass matches the expected sequence. Neither measurement alone shows that a vial holds the intended peptide. Peptide content, meaning the fraction of vial mass that is genuine peptide rather than counter-ion, water or residual acid, is reported separately and is frequently lower than the stated purity figure.
The regulatory position is broadly consistent across major jurisdictions: no thymosin beta-4 fragment is an approved medicine, and laboratory material is commonly labelled as not intended for human consumption. Anti-doping rules in sport list thymosin beta-4 and its fragments among prohibited peptide hormones. Because these products travel through research-chemical channels rather than pharmaceutical supply chains, quality varies considerably between vendors. Independent testing of identity, purity and sterility is the only dependable check, and a certificate of analysis describes one batch rather than a supplier's whole catalogue.
Lyophilized peptide powder is normally held desiccated at −20 °C, with −80 °C used for longer storage periods. Allowing a sealed vial to reach room temperature before opening is standard practice, because condensation forming on cold powder introduces moisture. Once dissolved, solutions are typically kept cold and shielded from light. Repeated freeze-thaw cycles are avoided because they encourage aggregation and gradual loss of material. These conventions are general to synthetic peptides rather than unique to any one sequence.
TB-500 is a research peptide whose sequence matches residues 17 to 23 of thymosin beta-4, a 43-residue protein present in most mammalian cells. The chain is seven amino acids long, written as LKKTETQ, and is normally supplied with an acetyl group on the N-terminus. Suppliers list it as a lyophilised powder under the code name TB-500, and the same sequence appears elsewhere in catalogues as the thymosin beta-4 actin-binding fragment. The label is commercial rather than systematic, so no single authority fixes exactly what TB-500 denotes.
Thymosin beta-4 was isolated from calf thymus in the early 1980s and later characterised as an abundant intracellular actin-sequestering protein. Interest in short synthetic fragments grew once the actin-binding motif had been mapped to the middle of the sequence. TB-500 came out of that line of work as a truncated analogue rather than a natural isolate, and it is now sold mainly to laboratories. Published studies on the fragment have been largely in vitro or in animal models, and controlled human trials remain sparse, so claims about effects in people rest on extrapolation.
The effects of glaciation were global. Antarctica was ice-bound throughout the Pleistocene and the preceding Pliocene. The Andes were covered in the south by the Patagonian ice cap. There were glaciers in New Zealand and Tasmania. The decaying glaciers of Mount Kenya, Mount Kilimanjaro, and the Ruwenzori Range in east and central Africa were larger. Glaciers existed in the mountains of Ethiopia and to the west in the Atlas Mountains. In the northern hemisphere, many glaciers fused into one. The Cordilleran Ice Sheet covered the North American northwest; the Laurentide covered the east. The Fenno-Scandian ice sheet covered northern Europe, including Great Britain; the Alpine ice sheet covered the Alps. Scattered domes stretched across Siberia and the Arctic shelf. The northern seas were frozen. During the late Upper Paleolithic (Latest Pleistocene) c. 18,000 BP, the Beringia land bridge between Asia and North America was blocked by ice, which may have prevented early Paleo-Indians such as the Clovis culture from directly crossing Beringia to reach the Americas. According to Mark Lynas (through collected data), the Pleistocene's overall climate could be characterized as a continuous El Niño with trade winds in the south Pacific weakening or heading east, warm air rising near Peru, warm water spreading from the west Pacific and the Indian Ocean to the east Pacific, and other El Niño markers. The Paleolithic is often held to finish at the end of the ice age (the end of the Pleistocene epoch), and Earth's climate became warmer.
Since DisplayPort's introduction in 2006, it has gained popularity within the computer industry and is featured on many graphics cards, displays, and notebook computers. Dell was the first company to introduce a consumer product with a DisplayPort connector, the Dell UltraSharp 3008WFP, which was released in January 2008. Soon after, AMD and Nvidia released products to support the technology. AMD included support in the Radeon HD 3000 series of graphics cards, and Nvidia first introduced support in the GeForce 9 series starting with the GeForce 9600 GT.
== Career == Chilkoti joined Duke University in 1996 as an assistant professor of biomedical engineering. He was promoted to associate professor in 2002 and professor in 2006. He was the Theo Pilkington Chair Professor of Biomedical Engineering from 2008 to 2013, and has been the Alan L. Kaganov Distinguished Professor of Biomedical Engineering at Duke University since 2013. From 2002 till 2007, Chilkoti served as associate director of the Center for Biologically Inspired Materials and Material Systems at Duke University and was the director of the center from 2007 to 2011. In 2014, he became Chair of the Department of Biomedical Engineering at Duke University and served as chair until 2022. As Chair of the Duke BME department, he launched an incubator—BRiDGE—for Biomedical Engineering faculty and student startups, and he created the Duke Engineering Entrepreneurship program (DEEP)—a post-doctoral fellowship program for recent PhD graduates of the department interested in entrepreneurship. Since 2023, he has been serving as the senior associate dean of Pratt School of Engineering at Duke University. Chilkoti founded two Gordon Research Conferences (GRCs)—one on Biointerface Science in 2006 and a second on Bioinspired Materials in 2012. Furthermore, he is the founder of five start-ups.
China was identified as interfering with the 2024 election through propaganda and disinformation campaigns linked to its Spamouflage operation. U.S. intelligence agencies described the effort as not targeting any particular candidate but focusing on issues important to the Chinese government, such as Taiwan, and "undermining confidence in elections, voting, and the U.S. in general". As early as April 1, 2024, The New York Times reported that the Chinese government had created fake pro-Trump accounts on social media "promoting conspiracy theories, stoking domestic divisions and attacking President Biden ahead of the election in November".
Sources: en.wikipedia.org
It is now known that organic compounds can be conductors, semiconductors, and insulators, thus one of the main opportunities in nanomaterials science is to use organic synthesis and molecular design to make electronically useful structures. Structural motifs in these systems include colloids, small crystals, and aggregates on the order of 1-100 nm. By function Nanostructured materials can also be classed according to their functions, for example nanoelectronics and information technology (IT). Lateral dimensions used in information storage are shrinking from the micro- to the nanoscale as fabrication technologies improve. Optical materials are important in the development of miniaturized information storage because light has many advantages for storage and transmission over electronic methods. Quantum dots - most commonly CdSe nanoparticles having diameters of tens of nm, and with protective surface coatings - are notable for their ability to fluoresce over a broad range of the visible spectrum, with the controlling parameter being size. By structure Certain structural classes are especially relevant to nanoscience. As the dimensions of structures become smaller, their surface area-to-volume ratio increases. Much like molecules, nanostructures at small enough scales are essentially "all surface". The mechanical properties of materials are strongly influenced by these surface structures. Fracture strength and character, ductility, and various mechanical moduli all depend on the substructure of the materials over a range of scales.
Lepirudin is an anticoagulant that functions as a direct thrombin inhibitor. Brand name: Refludan, Generic: Lepirudin rDNA for injection. Lepirudin is a recombinant hirudin derived from yeast cells. Lepirudin is almost identical to hirudin extracted from Hirudo medicinalis, having the amino acid sequence LTYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ with disulfide bridges at Cys6-Cys14, Cys16-Cys28 and Cys22-Cys39, and differs from by the substitution of leucine for isoleucine at the N-terminal end of the molecule and the absence of a sulfate group on the tyrosine at position 63. Lepirudin may be used as an anticoagulant when heparins (unfractionated or low-molecular-weight) are contraindicated because of heparin-induced thrombocytopenia.
junk RNA Any RNA-encoded sequence, especially a transcript, that appears to have no known biological function, or whose function has no positive or a net negative effect on the fitness of the genome from which it is transcribed. Despite remaining untranslated, many non-coding RNAs still serve important functions, whereas junk RNAs are truly useless: often they are the product of accidental transcription of a junk DNA sequence, or they may result from post-transcriptional processing of primary transcripts, as with spliced-out introns. Junk RNA is usually quickly degraded by ribonucleases and other cytoplasmic enzymes.
On 10 January 1973, negotiations broke down when Kissinger demanded the release of all American POWs in North Vietnam once a peace agreement was signed, but offered no guarantees about Viet Cong prisoners being held in South Vietnam. Tho stated: "I cannot accept your proposal. I completely reject it". Tho wanted the release of all prisoners once a peace agreement was signed, which led Kissinger to say this was an unreasonable demand. Tho, who had been tortured as a young man by the French colonial police for advocating Vietnamese independence, shouted: "You have never been a prisoner. You don't understand suffering. It's unfair". Kissinger finally offered the concession that the United States would use "maximum influence" to pressure the South Vietnamese government to release all Viet Cong prisoners within sixty days of a peace agreement being signed. Thiệu once again rejected the peace agreement, only to receive an ultimatum from Nixon: "You must decide now whether you desire to continue our alliance or whether you want me to seek a settlement with the enemy which serves U.S. interests alone". Nixon told Kissinger: "Brutality is nothing. You have never seen it if this son-of-a-bitch doesn't go along, believe me". Nixon's threat served its purpose, and Thiệu reluctantly accepted the peace agreement. On 23 January 1973, at 12:45 pm, Kissinger and Tho signed a peace agreement in Paris that called for the complete withdrawal of all U.S. forces from Vietnam by March in exchange for North Vietnam freeing all the U.S. POWs.
== Limitations == Some medical conditions or problems with the blood sample may produce inaccurate results. If the sample is visibly clotted, which can be caused by poor phlebotomy technique, it is unsuitable for testing, because the platelet count will be falsely decreased and other results may be abnormal. Samples stored at room temperature for several hours may give falsely high readings for MCV (mean corpuscular volume), because red blood cells swell as they absorb water from the plasma; and platelet and white blood cell differential results may be inaccurate in aged specimens, as the cells degrade over time.
Sources: en.wikipedia.org
No. Thymosin beta-4 is a 43-residue natural peptide, while TB-500 is a commercial label applied to a short synthetic fragment of it. The two differ in length, sequence coverage and how they are handled in the laboratory.
Published work usually examines actin binding, cell migration and tissue repair endpoints in cell and animal models. Findings are generally described as preliminary, and controlled human data remain limited.
Because TB-500 is a trade name rather than a chemical identifier, different vendors and papers may attach it to different fragment lengths. Checking the stated sequence is the practical way to resolve the ambiguity.
Divide it into single-use aliquots and hold them frozen at -20 °C or below, protected from light. Repeated thawing of one container is the main avoidable source of variability.