The short version of thymosin beta-4 fits in a sentence. The long version — which is the one that helps — is below.
This page was last updated on 2025-08-14 and is reviewed periodically as new material appears.
Lyophilized peptide arrives as a dry cake that should stay sealed until use. Reconstitution is generally performed with sterile water or a buffered solution, and the resulting liquid should be handled gently to limit mechanical stress. Repeated freeze-thaw cycles are widely described as harmful to short peptides, so dividing a reconstituted batch into single-use portions is a common practice. Laboratories also record the solvent, concentration, and date of preparation on the vial label to keep later measurements traceable.
Dry powder is commonly held at minus twenty degrees Celsius, with some suppliers recommending lower temperatures for long-term archival storage. Once dissolved, solutions are typically kept cold and protected from light, since aqueous peptide solutions can lose integrity through hydrolysis or oxidation over time. Stability data specific to this fragment are limited in the public literature, and much of the guidance comes from general peptide handling practice rather than from controlled degradation studies. Users therefore treat stated shelf lives as approximate rather than fixed.
Identity and purity are normally assessed with reversed-phase high-performance liquid chromatography, paired with mass spectrometry to confirm molecular mass. A certificate of analysis reports a purity percentage, usually derived from chromatographic peak area, but that figure does not by itself prove a correct sequence or the absence of counterions. Independent verification may include amino acid analysis or peptide mapping. Batch-to-batch variation is a documented concern in the research chemical market, and the gap between a quoted purity value and actual peptide content can be substantial when the material is a salt or retains residual water.
Proposed activity centers on actin sequestration and on the movement of cells during repair processes. In cell culture and animal models, the fragment has been associated with migration, tube formation, and tissue remodeling. These observations are frequently described as preliminary, because most published work uses rodent or in vitro systems rather than controlled human trials. Whether the short fragment reproduces the effects of the full protein remains an open question, and the relationship between dose, route, and measured outcome is not well characterized.
The compound circulates in the literature as a research reagent rather than an approved therapeutic. Regulatory agencies in several countries have not authorized it for medical use, and sporting bodies list related thymosin beta-4 peptides among prohibited substances. Suppliers typically market it with a purity figure and a certificate of analysis, while peer-reviewed clinical reports remain sparse. Discussions therefore often separate laboratory findings from anecdotal reports, and reviewers tend to note the small size and methodological limits of the available studies.
TB-500 refers to a synthetic peptide fragment derived from the actin-binding region of thymosin beta-4, a protein present in most mammalian cells. The full protein contains forty-three amino acids, while the commonly sold fragment is a much shorter acetylated sequence, often cited as LKKTETQ. The fragment retains part of the actin-binding motif but lacks the remainder of the parent protein. Material sold under this name is usually lyophilized powder intended for laboratory research, and it is not a finished pharmaceutical product.
| Property | Value | Notes |
|---|---|---|
| Molecular mass | Approximately 0.9 kDa | Depends on exact fragment sequence and counterion |
| Amino acid sequence | LKKTETQ (commonly cited) | Short actin-binding motif from thymosin beta-4 |
| Common salt form | Acetate salt | Trifluoroacetate also reported in research material |
| Reconstitution solvent | Sterile water or buffer | Gentle mixing; avoid vigorous agitation |
| Solution storage | -20 °C or lower | Aliquot to avoid repeated freeze-thaw cycles |
Lyophilised peptide is normally reconstituted with sterile water or a neutral buffer shortly before use. Because repeated freeze-thaw cycles can degrade the material, dividing a reconstituted solution into single-use aliquots is a common practice. Working solutions are usually kept cold and protected from light. The exact shelf life depends on concentration, buffer composition, and handling, so it is often determined empirically rather than assumed.
Peptide bonds are susceptible to hydrolysis under extreme pH and to enzymatic cleavage if proteases are present. Heat, oxidising agents, and prolonged exposure to light also contribute to loss of material. Aggregation can occur at high concentrations or in certain buffer systems, and it may not be visible to the eye. Storage at -20 C or below is typical for both powder and aliquoted solutions, and desiccation of the powder is preferred.
Identity and purity are usually assessed by reversed-phase high-performance liquid chromatography together with mass spectrometry. The chromatogram provides a purity estimate as a percentage of total peak area, while the mass spectrum confirms that the observed mass matches the expected value. Amino acid analysis or tandem mass spectrometry sequencing can provide additional confirmation. Reported purity figures depend on the column, gradient, and detection wavelength, so values from different laboratories are not directly comparable without method details.
TB-500 is a synthetic seven-amino-acid peptide with the sequence LKKTETQ, corresponding to residues 17 through 23 of the protein thymosin beta-4. The N-terminus is typically acetylated in the described form, giving a monoisotopic mass near 888.5 Da and an average mass of about 889 Da. The designation TB-500 is a catalogue label rather than a formal chemical name, and the same sequence appears in the literature under several alternative abbreviations. It is handled as a research reagent rather than a pharmaceutical product.
Thymosin beta-4 is a 43-residue actin-binding protein found in most mammalian cell types, where it participates in cytoskeletal regulation and cell migration. TB-500 represents only a short fragment of that protein and does not include the remaining residues. Whether the isolated fragment reproduces the full range of activities reported for the intact protein remains an open question. Researchers commonly treat the two as related but distinct entities when comparing results.
Published work involving this sequence spans actin-binding assays, cell-migration studies, wound-healing models, and cardiovascular or musculoskeletal experiments. Much of the biological rationale derives from in vitro systems and animal models, and the number of controlled human studies is small. Reported outcomes vary across preparations, doses, and routes, which complicates comparison between studies. Reviews generally describe the evidence base as preliminary rather than settled. Mechanistic explanations are often proposed by analogy to the parent protein rather than demonstrated directly.
== See also == Philippine resistance against Japan Philippine Constabulary (PC) Military history of the Philippines List of American guerrillas in the Philippines Thomas Flynn (Columban priest) Communist rebellion in the Philippines
=== Mesosoma === Both the wings and the 6 legs of the ant are attached to the mesosoma ("thorax"). The legs terminate in a hooked claw which allows them to hook on and climb surfaces. Only reproductive ants (queens and males) have wings. Queens shed their wings after the nuptial flight, leaving visible stubs, a distinguishing feature of queens. In a few species, wingless queens (ergatoids) and males occur.
Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion. When externally administered, GLP-2 produces a number of effects in humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection. GLP-2 may act in an endocrine fashion to link intestinal growth and metabolism with nutrient intake. GLP-2 and related analogs (such as Teduglutide) may be treatments for short bowel syndrome, Crohn's disease, osteoporosis and as adjuvant therapy during cancer chemotherapy. GLP-2 has an antidepressant effect in a mouse model of depression when delivered via intracerebroventricular injection. However, a GLP-2 derivative (PAS-CPP-GLP-2) was shown to be efficiently delivered to the brain intranasally, with similar efficacy.
diphtheriae infection (Barcoo rot, diphtheric desert sore, septic sore, Veldt sore) Cutaneous group B streptococcal infection Cutaneous Pasteurella hemolytica infection Cutaneous Streptococcus iniae infection Dermatitis gangrenosa (gangrene of the skin) Ecthyma Ecthyma gangrenosum Ehrlichiosis ewingii infection Elephantiasis nostras Endemic typhus (murine typhus) Epidemic typhus (epidemic louse-borne typhus) Erysipelas (ignis sacer, Saint Anthony's fire) Erysipeloid of Rosenbach Erythema marginatum Erythrasma External otitis (otitis externa, swimmer's ear) Felon Flea-borne spotted fever Flinders Island spotted fever Flying squirrel typhus Folliculitis Fournier gangrene (Fournier gangrene of the penis or scrotum) Furunculosis (boil) Gas gangrene (clostridial myonecrosis, myonecrosis) Glanders (equinia, farcy, malleus) Gonococcemia (arthritis–dermatosis syndrome, disseminated gonococcal infection) Gonorrhea (clap) Gram-negative folliculitis Gram-negative toe web infection Granuloma inguinale (Donovanosis, granuloma genitoinguinale, granuloma inguinale tropicum, granuloma venereum, granuloma venereum genitoinguinale, lupoid form of groin ulceration, serpiginous ulceration of the groin, ulcerating granuloma of the pudendum, ulcerating sclerosing granuloma) Green nail syndrome Group JK Corynebacterium sepsis Haemophilus influenzae cellulitis Helicobacter cellulitis Hospital furunculosis Hot tub folliculitis (Pseudomonas aeruginosa folliculitis) Human granulocytotropic anaplasmosis Human monocytotropic ehrlichiosis Impetigo contagiosa Japanese spotted fever Leptospirosis (Fort Bragg fever, pretibial fever, Weil's disease) Listeriosis Ludwig's angina Lupoid sycosis Lyme disease (Afzelius' disease, Lyme borreliosis) Lymphogranuloma venereum (climatic bubo, Durand–Nicolas–Favre disease, lymphogranuloma inguinale, poradenitis inguinale, strumous bubo) Malakoplakia (malacoplakia) Mediterranean spotted fever (Boutonneuse fever) Melioidosis (Whitmore's disease) Meningococcemia Missouri Lyme disease Mycoplasma infection Necrotizing fasciitis (flesh-eating bacteria syndrome) Neonatal toxic shock-like exanthematous disease Nocardiosis Noma neonatorum North Asian tick typhus Ophthalmia neonatorum Oroya fever (Carrion's disease) Pasteurellosis Perianal cellulitis (perineal dermatitis, streptococcal perianal disease) Periapical abscess Pinta Pitted keratolysis (keratolysis plantare sulcatum, keratoma plantare sulcatum, ringed keratolysis) Plague Primary gonococcal dermatitis Pseudomonal pyoderma Pseudomonas hot-foot syndrome Pyogenic paronychia Pyomyositis Q fever Queensland tick typhus Rat-bite fever Recurrent toxin-mediated perineal erythema Rhinoscleroma Rickettsia aeschlimannii infection Rickettsialpox Rocky Mountain spotted fever Saber shin (anterior tibial bowing) Saddle nose Salmonellosis Scarlet fever Scrub typhus (Tsutsugamushi fever) Shigellosis Staphylococcal scalded skin syndrome (pemphigus neonatorum, Ritter's disease) Streptococcal intertrigo Superficial pustular folliculitis (impetigo of Bockhart, superficial folliculitis) Sycosis vulgaris (barber's itch, sycosis barbae) Syphilid Syphilis (lues) Tick-borne lymphadenopathy Toxic shock syndrome (streptococcal toxic shock syndrome, streptococcal toxic shock-like syndrome, toxic streptococcal syndrome) Trench fever (five-day fever, quintan fever, urban trench fever) Tropical ulcer (Aden ulcer, jungle rot, Malabar ulcer, tropical phagedena) Tularemia (deer fly fever, Ohara's disease, Pahvant Valley plague, rabbit fever) Verruga peruana Vibrio vulnificus infection Yaws (bouba, frambösie, parangi, pian)
Sources: en.wikipedia.org
== History == The term gynaecomastia was coined by Galen. He also recognised glandular enlargement of the male breast; however, this wasn't a condition of gynaecomastia according to him. A surgical procedure for treatment of gynaecomastia was described by Albucasis in his second book of Kitab al-Tasrif.
Alveolar crest fibers (I) run from the cervical part of the root to the alveolar bone crest. Horizontal fibers (J) attach to the cementum apical to the alveolar crest fibers and run perpendicularly from the root of the tooth to the alveolar bone. Oblique fibers (K) are the most numerous fibers in the periodontal ligament, running from cementum in an oblique direction to insert into bone coronally. These fibers resist vertical and intrusive forces. Apical fibers are found radiating from cementum around the apex of the root to the bone, forming base of the socket or alveolus. Interradicular fibers are only found between the roots of multirooted teeth, such as premolars and molars. They extend from radicular cementum to interradicular alveolar bone.
Some bodybuilders inject oils or other compounds into their muscles (sometimes known as "synthol") to enhance their size or appearance. This practice can have serious health consequences and risks for humans.
Sources: en.wikipedia.org
Dry lyophilized powder is usually kept frozen, desiccated, and out of direct light. Sealed vials are not opened until needed, because moisture uptake can degrade short peptides. Longer archival storage is often done at lower temperatures than routine working stock.
Reversed-phase liquid chromatography separates components and reports purity from peak area. Mass spectrometry confirms the molecular mass expected for the sequence. Additional approaches such as peptide mapping or amino acid analysis provide independent confirmation.
Reported percentages depend on the analytical method, the detection wavelength, and whether salts and water are counted. A value above ninety-five percent by chromatography does not by itself establish a correct sequence. Different suppliers also calculate purity against different reference standards.
TB-500 is a name used for a short synthetic peptide fragment taken from the actin-binding region of thymosin beta-4. Material sold under this label is usually a lyophilized powder supplied for laboratory research rather than a licensed medicine. The commonly cited sequence is LKKTETQ.