The short version of thymosin beta-4 fragment fits in a sentence. The long version — which is the one that helps — is below.
This page was last updated on 2026-04-21 and is reviewed periodically as new material appears.
The seven-residue chain carries several polar and charged side chains, so it dissolves readily in water and in aqueous buffers near neutral pH. No cysteine is present, so disulphide formation is not a concern and reducing agents are unnecessary. Dilute ammonium hydroxide or acetonitrile-water mixtures are sometimes used for stock solutions when initial dissolution is slow. Strongly alkaline conditions and prolonged contact with oxidising agents are avoided because they can modify lysine-containing stretches, and haze in solution usually signals incomplete dissolution or aggregated material.
Identity and purity are checked with reversed-phase high-performance liquid chromatography, which separates the target sequence from truncated or deletion analogues, and with mass spectrometry, which confirms the expected molecular mass. Amino acid analysis and peptide mapping give orthogonal confirmation but are used less often outside specialist laboratories. Counter-ion content varies: material purified on trifluoroacetic acid gradients retains trifluoroacetate, and ion exchange can convert the salt form. Residual water and solvent are measured by Karl Fischer titration or thermogravimetric analysis, and any purity figure should be read together with the method used to obtain it.
The regulatory position is broadly consistent across major jurisdictions: no thymosin beta-4 fragment is an approved medicine, and laboratory material is commonly labelled as not intended for human consumption. Anti-doping rules in sport list thymosin beta-4 and its fragments among prohibited peptide hormones. Because these products travel through research-chemical channels rather than pharmaceutical supply chains, quality varies considerably between vendors. Independent testing of identity, purity and sterility is the only dependable check, and a certificate of analysis describes one batch rather than a supplier's whole catalogue.
Lyophilized peptide powder is normally held desiccated at −20 °C, with −80 °C used for longer storage periods. Allowing a sealed vial to reach room temperature before opening is standard practice, because condensation forming on cold powder introduces moisture. Once dissolved, solutions are typically kept cold and shielded from light. Repeated freeze-thaw cycles are avoided because they encourage aggregation and gradual loss of material. These conventions are general to synthetic peptides rather than unique to any one sequence.
Purity and identity are separate measurements and are often confused. Reverse-phase high-performance liquid chromatography, usually with ultraviolet detection near 214 nanometres, reports the share of total peak area belonging to the target compound. Mass spectrometry by electrospray or matrix-assisted laser desorption then checks whether the observed mass matches the expected sequence. Neither measurement alone shows that a vial holds the intended peptide. Peptide content, meaning the fraction of vial mass that is genuine peptide rather than counter-ion, water or residual acid, is reported separately and is frequently lower than the stated purity figure.
| Property | Value | Notes |
|---|---|---|
| Water content | Low in freshly lyophilised material | Rises after repeated opening of the same vial |
| Solution stability | Lower than powder stability | Frozen aliquots are preferred over repeated thawing |
| Purity assessment | Reversed-phase HPLC with UV detection | Peak-area percentage excludes salts and water |
| Salt form | Often the trifluoroacetate salt | Retained from acidic purification gradients |
| Light sensitivity | Not strongly photoreactive | Dark storage still advised for long-term keeping |
Thymosin beta-4 is a 43-residue actin-binding protein found in most mammalian cell types, where it participates in cytoskeletal regulation and cell migration. TB-500 represents only a short fragment of that protein and does not include the remaining residues. Whether the isolated fragment reproduces the full range of activities reported for the intact protein remains an open question. Researchers commonly treat the two as related but distinct entities when comparing results.
Published work involving this sequence spans actin-binding assays, cell-migration studies, wound-healing models, and cardiovascular or musculoskeletal experiments. Much of the biological rationale derives from in vitro systems and animal models, and the number of controlled human studies is small. Reported outcomes vary across preparations, doses, and routes, which complicates comparison between studies. Reviews generally describe the evidence base as preliminary rather than settled. Mechanistic explanations are often proposed by analogy to the parent protein rather than demonstrated directly.
Controlled human trials of the short fragment are scarce. Much of what appears in review articles is extrapolated from animal models or from studies of the parent protein, and literature searches return a larger body of cardiac and ophthalmic work on thymosin beta-4 than on the abbreviated peptide. Regulatory treatment differs by jurisdiction, and in several countries the material is handled as a research chemical rather than an approved therapeutic. Statements about human benefit should be read as provisional.
Biological interest in this peptide centers on its relationship to actin dynamics. Thymosin beta-4 binds monomeric actin through an LKKTET motif, and a short sequence carrying that motif can compete with other actin-binding proteins in cell-free preparations. Investigators propose that such competition shifts the balance between filament assembly and disassembly, which in turn affects how readily a cell extends protrusions and migrates. Most of the supporting observations come from cultured cells and purified protein systems rather than from intact organisms.
TTP's (ZFP36's) expression is rapidly induced by insulin. Immunoprecipitation experiments have shown that TTP co-precipitates with an exosome, suggesting that it helps recruit exosomes to the mRNA containing AREs. TTP appears to promote the processive deadenylation activity of CCR4–NOT on mRNAs containing AREs, with phosphorylation-dependent interactions with cytoplasmic poly(A)-binding protein (PABPC1) potentially enhancing deadenylation and promoting regulated mRNA decay. TTP can also repress mRNA translation after binding to AREs by using 4EHP-GYF2 as a cofactor. Alternatively, HuR proteins have a stabilizing effect—their binding to AREs increases the half-life of mRNAs. Similar to other RNA-binding proteins, this class of proteins contain three RRMs, two of which are specific to ARE elements. A likely mechanism for HuR action relies on the idea that these proteins compete with other proteins that normally have a destabilizing effect on mRNAs. HuRs are involved in genotoxic response—they accumulate in the cytoplasm in response to UV exposure and stabilize mRNAs that encode proteins involved in DNA repair.
AnIML Core AnIML Technique Definitions Additionally, AnIML Technique Definition Documents apply constraints to the AnIML Core and are specified by the AnIML Technique Definitions. The AnIML Core consists of a set of rules defining the structure of the XML document, providing a universal container for arbitrary analytical data. AnIML Technique Definitions describe how to use the AnIML Core to record experiments of a particular scientific discipline. There is a big similarity between the mechanisms of AnIML and the AVI format. The AnIML Core defines the data container, whereas the AnIML Technique Definitions act similar to the AVI codec. It defines how the data needs to be structured and labeled. Technique Definitions are XML documents, specified by the Technique Schema. official website AnIML on GitHub
Cell membranes are generally impermeable to charged or large, polar molecules because of the lipophilic fatty acyl chains comprising their interior. Many biologically important molecules, including a number of pharmaceutical agents, are organic weak acids that can cross the membrane in their protonated, uncharged form but not in their charged form (i.e., as the conjugate base). For this reason the activity of many drugs can be enhanced or inhibited by the use of antacids or acidic foods. The charged form, however, is often more soluble in blood and cytosol, both aqueous environments. When the extracellular environment is more acidic than the neutral pH within the cell, certain acids will exist in their neutral form and will be membrane soluble, allowing them to cross the phospholipid bilayer. Acids that lose a proton at the intracellular pH will exist in their soluble, charged form and are thus able to diffuse through the cytosol to their target. Ibuprofen, aspirin and penicillin are examples of drugs that are weak acids.
"Chelating agents are organic compounds which are capable of linking to metal ions". They are usually useful for removing toxic heavy metal ions from body. Dimercaprol is a common chelating agent to treat toxic exposure to arsenic, mercury, gold, and lead. It is in the chelating class of drugs. From Figure 3, the SH-ligands of dimercaprol can compete with -SH groups in natural enzymes for heavy metal, forming a stable metal complex to be excreted through urine. The action antagonises the toxic metal ions and helps remove them from body circulation. However, dimercaprol has a narrow TI and is later replaced by its derivative, 2,3-dimercaptosuccinic acid (DMSA). Neutralising antibodies block pathogen entry into cells to prevent further infection and replication. Infliximab is a monoclonal antibody binding with tumour necrosis factor-alpha (TNF-alpha), inhibiting its pro-inflammatory action. Its efficacious anti-inflammatory action is clinically used in Crohn's Disease, active rheumatoid arthritis, psoriatic arthritis, and active ankylosing spondylitis.
12(S)-HETE and 12(S)-HpETE stimulate the dilation of rat mesenteric arteries; 12(S)-HETE stimulates the dilation of coronary microvessels in pigs and the mesenteric arteries of mice, one or more of these three metabolites are implicated in the vasodilation of rat basilar artery, 12(R)-HETE and to a slightly lesser extent 12(S)-HETE constrict the renal artery of dogs and 12-HETE (stereoisomer undetermined) is implicated in the angiotensin II-induced arterial hypertension response of human placenta. The vasodilating effect on mouse mesenteric arteries appears due to 12S-HETE's ability to act as a thromboxane receptor antagonist and thereby block the vasoconstricting actions of thromboxane A2. These results indicate that the cited metabolites have dilating or constricting effects that depend on the arterial vascular site and or species of animal examined; their role in human blood pressure regulation is unclear. Excessive 12-HETE production is implicated in psoriasis. 5-Hydroxyeicosatetraenoic acid 15-Hydroxyeicosatetraenoic acid
Sources: en.wikipedia.org
The histology of ALK-negative ALCL, similar to ALK-positive ALCL, consist of "hallmark" cells that strongly express CD30. Unlike ALK-positive ALCL, however, ALK-negative ALC does not fall into different morphological patterns. The histological of this disease may overlap with and be difficult to distinguish from other CD30-positive T-cell lymphomas or the nodular sclerosis form of Hodgkin lymphoma. Cases in which ALK-negative ALCL is not distinguishable from the latter lymphomas are best diagnosed as peripheral T-cell lymphoma not otherwise specified (PTL, NOS). The histology of ALK-negative ALCL may also overlap with tumors of non–T-cell lineage such as various carcinomas. The differential diagnoses of ambiguous cases may be helped by examining the tumor cells for the expression of certain marker proteins. For example, expression of CD56, MUC1 (also termed EMA for epithelial membrane antigen), and clusterin and strong uniform expression of CD30 support the diagnosis of ALK-negative ALCL over PTL, NOS, while variable CD30 expression and extensive expression of T-cell receptor proteins favor PTCL-NOS over ALK-negative ALCL. Detection of certain gene abnormalities (see next section) may also help distinguishing these diseases.
Isoforms I, III, and VIII are also stimulated by Ca2+/calmodulin. Isoforms V and VI are inhibited by Ca2+ in a calmodulin-independent manner. Isoforms II, IV and IX are stimulated by alpha subunit of the G protein. Isoforms I, V and VI are most clearly inhibited by Gi, while other isoforms show less dual regulation by the inhibitory G protein. Soluble AC (sAC) is not a transmembrane form and is not regulated by G proteins or forskolin, instead acts as a bicarbonate/pH sensor. It is anchored at various locations within the cell and, with phosphodiesterases, forms local cAMP signalling domains. In neurons, calcium-sensitive adenylyl cyclases are located next to calcium ion channels for faster reaction to Ca2+ influx; they are suspected of playing an important role in learning processes. This is supported by the fact that adenylyl cyclases are coincidence detectors, meaning that they are activated only by several different signals occurring together. In peripheral cells and tissues adenylyl cyclases appear to form molecular complexes with specific receptors and other signaling proteins in an isoform-specific manner.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Aerosol mass spectrometry is the application of mass spectrometry to the analysis of the composition of aerosol particles. Aerosol particles are defined as solid and liquid particles suspended in a gas (air), with size range of 3 nm to 100 μm in diameter and are produced from natural and anthropogenic sources, through a variety of different processes that include wind-blown suspension and combustion of fossil fuels and biomass. Analysis of these particles is important owing to their major impacts on global climate change, visibility, regional air pollution and human health. Aerosols are very complex in structure, can contain thousands of different chemical compounds within a single particle, and need to be analysed for both size and chemical composition, in real-time or off-line applications. Off-line mass spectrometry is performed on collected particles, while on-line mass spectrometry is performed on particles introduced in real time.
Sources: en.wikipedia.org
Divide it into single-use aliquots and hold them frozen at -20 °C or below, protected from light. Repeated thawing of one container is the main avoidable source of variability.
Mass spectrometry confirms identity, because the measured mass is compared with the value expected from the sequence. Chromatography mainly reports how much of the material elutes as the target peak.
It usually describes the share of the chromatographic peak area recorded at a set wavelength. Salts, residual water, and solvent are excluded from that number, so it is not the same as mass fraction.
Desiccated storage at −20 °C is conventional, with −80 °C for extended periods. Vials should be warmed to room temperature before opening to prevent condensation on the powder.